PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc06_g06140
Common NameGSCOC_T00031420001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family NAC
Protein Properties Length: 253aa    MW: 28740 Da    PI: 6.0401
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc06_g06140genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM147.47.4e-4641341127
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                  lppGfrF Pt+eel+++yL+ k+eg++ ++++vi+ vdiy+++PwdLp+    +++++ ++w+fF++ + ++a+g r+nr t++gyWkatg+   v+s
  Cc06_g06140   4 LPPGFRFYPTEEELISFYLHSKLEGRRQDIDTVIPVVDIYDHKPWDLPQfageCCRGDPEQWFFFIPMQDREARGGRPNRLTTEGYWKATGSPGCVYS 101
                  79****************************999***************656766666888************************************** PP

          NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyr 127
                  ++++ +g+k+t+vfykgrap+gekt+W m+ey+
  Cc06_g06140 102 SQNRIIGVKRTMVFYKGRAPNGEKTQWKMNEYK 134
                  ********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.07E-482159IPR003441NAC domain
PROSITE profilePS5100548.0624160IPR003441NAC domain
PfamPF023651.3E-225134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MENLPPGFRF YPTEEELISF YLHSKLEGRR QDIDTVIPVV DIYDHKPWDL PQFAGECCRG  60
DPEQWFFFIP MQDREARGGR PNRLTTEGYW KATGSPGCVY SSQNRIIGVK RTMVFYKGRA  120
PNGEKTQWKM NEYKAIDGEA SSAAPPKLRQ EMSLCRLYIG SKSLRAFDRR PPPPPGETSS  180
HHRQPHHQED QPASITSHQT HPPSLAAEIA SSTSGSGEDN FLASSSQGLE NESHDLAFNP  240
EPMWDWEQLN WF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-33315814166Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002276192.12e-98PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR33e-81NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A068UQS70.0A0A068UQS7_COFCA; Uncharacterized protein
STRINGVIT_08s0007g02940.t017e-98(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.12e-82NAC domain containing protein 90